NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315533_1002674

Scaffold Ga0315533_1002674


Overview

Basic Information
Taxon OID3300031643 Open in IMG/M
Scaffold IDGa0315533_1002674 Open in IMG/M
Source Dataset NameSalt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-30
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12197
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (61.11%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.722Long. (o)-70.847Alt. (m)Depth (m).3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031354Metagenome / Metatranscriptome182Y
F059653Metagenome / Metatranscriptome133Y
F091296Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0315533_10026742F031354AGGAMKTTFDINDILFPIVNVASVQATINGRVYRNKKALNSELRDIIIIPLTNHNGDEIINEATFMVNCYCKNFNNGTPDIARLRLIAEAVIAVIEAYNSASKYYVFDIVNQILLPDTDQKSMSYVNLRINCFIEK
Ga0315533_10026744F091296GGAGMVMKRYPHTATISYYGAGTTNSIGIYTEGTLVTIGIVCNIQPNSTKYIIGESGNMIGYNWYIMSPLFTGVNSVPDDAKLTFFNKEHVILDLFPYQKHVEMKC
Ga0315533_10026745F059653AGGAGMTNKEALQSQTEYSNDNLLEKLLLDRGLATGGTYAAANAKDIDLAAASLYFTLAAHPELREGAFTVKYSGVQLIAMAKMILQKYGEDVATVNGAAIW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.