Scaffold Ga0307274_1029531

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307274_1029531

Scaffold Ga0307274_1029531

Overview

Basic Information
Taxon OID	3300031661 Open in IMG/M
Scaffold ID	Ga0307274_1029531 Open in IMG/M
Source Dataset Name	Metatranscriptome of freshwater viral communities from high-CO2 subsurface aquifer at Crystal Geyser, Utah, USA - CG05 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	678
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Subsurface Water → Freshwater Rna Viral Communities From High-co2 Subsurface Aquifer At Crystal Geyser, Utah, Usa

Source Dataset Sampling Location
Location Name	USA: Utah
Coordinates	Lat. (^o)	38.9383	Long. (^o)	-110.1342	Alt. (m)		Depth (m)	800
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066449	Metagenome / Metatranscriptome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307274_10295311	F066449	GAG	MTQLVKTLSLSPYNKIILFESVSVLKRCFLGIYALDLKPSLMNFINISLGDINFTHHFTLSPYCKYFECKGKSIFQGNILIKNTSIDTPHLISATEI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.