NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316579_10010816

Scaffold Ga0316579_10010816


Overview

Basic Information
Taxon OID3300031691 Open in IMG/M
Scaffold IDGa0316579_10010816 Open in IMG/M
Source Dataset NameRhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3865
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Rhizosphere Microbial Communities From Salt Marsh Grasses In Alabama, United States

Source Dataset Sampling Location
Location NameUSA: Alabama
CoordinatesLat. (o)30.2619Long. (o)-88.2383Alt. (m)Depth (m).05 to .07
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F086602Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
Ga0316579_100108161F086602N/AHRGTLDGLLRLFFDKGGYSGQNFRALADEPTVHFYTPAVRYPDSVAQWEQLQETDFDSEPFVFDKHADLPVGERPAYRLADTEMTINVWQKQKVVDTVTLRAIVVHDPQGEKPAERWPVVLLTNDRQIDARDLLNEFGDHWGQEFGHRIGKHDLYLDILPQGYVLRTQRDDEGQLHREVEYDQTALFLSAWLRCLVFNLMSRFAQAVGGEYAKMWAGTLLRKFIRRPATLYLVGKELHVVFDPFPGQDELQPLLDRLNAKRTPLPWLNDLIVQFSIAQDEPLHPLTEPEKRNRLFGDGEH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.