NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0302139_10331754

Scaffold Ga0302139_10331754


Overview

Basic Information
Taxon OID3300031693 Open in IMG/M
Scaffold IDGa0302139_10331754 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - CBN3_33.1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)616
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → unclassified Flavobacteriia → Flavobacteriia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)80.9595Long. (o)-132.1842Alt. (m)Depth (m)139
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008820Metagenome / Metatranscriptome327Y
F054099Metagenome / Metatranscriptome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0302139_103317541F054099AGGAMQTNQQVYEDAQYQASDPIGTQEAIPAGVHDIELSWDRKRGYMRIIINNQTWHFKEYLGKAQITGTDNTRGRIYLRAMARIDGETLT
Ga0302139_103317542F008820AGGAGGMADLTQYLTQKYTKLITEITADLGKTADDLANAQNILKALKNPDMTVDGMSLTLDMIQIMENGDIRILPPPPAPAITETCIQEPKSNGKKDIKDLVNAN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.