Scaffold Ga0310813_10494402

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0310813_10494402

Scaffold Ga0310813_10494402

Overview

Basic Information
Taxon OID	3300031716 Open in IMG/M
Scaffold ID	Ga0310813_10494402 Open in IMG/M
Source Dataset Name	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1068
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Experimental Microcosm In Duke University, North Carolina, United States

Source Dataset Sampling Location
Location Name	USA: North Carolina
Coordinates	Lat. (^o)	36.0	Long. (^o)	-78.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096887	Metagenome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0310813_104944021	F096887	AGGA	MSKNASLAQLNSNGMVLASCLTILSVLLALGIGIRVMLQNDFRILANLRSSTHSFYYSVAGIEWSKNEIAEIDAFPPAPVNQTKSFANGAFDVTFSAPAVMGPLTARLTVRSIGTAANAAHIIEAQLMKAYELSDAALAVRGNPVRALLSGGEILISGADHDQTNGTARSGAKPRLAISASSELVRELLFQSIEAPEVLDPASLTPAVGQSDYLPATFVNQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.