NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307474_10137380

Scaffold Ga0307474_10137380


Overview

Basic Information
Taxon OID3300031718 Open in IMG/M
Scaffold IDGa0307474_10137380 Open in IMG/M
Source Dataset NameHardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1840
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)39.0844Long. (o)-86.4705Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015004Metagenome / Metatranscriptome258Y
F020232Metagenome / Metatranscriptome225Y
F045388Metagenome / Metatranscriptome153N

Sequences

Protein IDFamilyRBSSequence
Ga0307474_101373801F015004N/AVNELRMPADVAQGSPGMVAFGDMILFVLVTGFVGVVPTWFLPRLIIAKAPRALFAIVLLIAAMGPVSWLAVRHMASGLHPPNPPEAVGALLGLFIAFVAIPRMVLGPVVVVIEAVTIFLVHGRVTRALLAVAMLMDLVPLGMFAFHMLRATRY
Ga0307474_101373802F020232GGAGGMAEPSTDPIPPDFAEAFAYAVLVYEIWTPEEPGRLIEIGSRSYSIVEVCRFVDQFTDRLPERVYLKLRSYLHDYPDGKLKADLAADPSYATAVRCLRGMIERRTEDFKQRGGMAG
Ga0307474_101373803F045388GAGGVRSSHLTDDDLWRVIANNTDAMSMLIEKQFELDGEAGAPDPDTRQKLMLFNVQAIDNYDRQYRDCIAEIRRRYPSI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.