NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315907_10075826

Scaffold Ga0315907_10075826


Overview

Basic Information
Taxon OID3300031758 Open in IMG/M
Scaffold IDGa0315907_10075826 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2906
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (91.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.6898Long. (o)-83.2813Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002071Metagenome / Metatranscriptome596Y
F038643Metagenome / Metatranscriptome165Y
F078406Metagenome / Metatranscriptome116N

Sequences

Protein IDFamilyRBSSequence
Ga0315907_1007582611F002071AGGAMATTLEIGQTFTTEKSGVVGVIKAVDNHPSGVARILLDVNGSERWTSVSI
Ga0315907_100758268F038643AGGAMSDFANWKSYPFTVEGVEFVSLIDPNGSMYSQIKRVPSQVFSQMNEQAIREIIGSISNLTKSEIQAELDKINLGYSQAYLALA
Ga0315907_100758269F078406AGGAMLSTATALIQATEDSIFDEEVMGFAQAFCQHAPQLDEQQFAKSIYVYSCMLASLAVDKAMKVLLSEDEIINLMNAIDELETMRDEVMNNGE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.