NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308415_1033357

Scaffold Ga0308415_1033357


Overview

Basic Information
Taxon OID3300031776 Open in IMG/M
Scaffold IDGa0308415_1033357 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS55
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1356
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002970Metagenome / Metatranscriptome517N
F005302Metagenome / Metatranscriptome405Y

Sequences

Protein IDFamilyRBSSequence
Ga0308415_10333572F002970GGAGMSYSSVTDIIELLAGLAVQYNSAVVPVQRLATQPSWSDAAQLPVRIIPALGGLRLVEGGVYTPTRATRAVWEIDDLLLVRDVGMGRGVADTAAALVDYIEDYVAQLRFAWRMRGDVQLINVSGIVDIVRYGERAYEGVAMTTRFAHLVRAPST
Ga0308415_10333573F005302AGGAGGMSHSGVIDGLYAGNFAVEISTNLTTWTAVSNATVKIDDVELSRPSGEAYVGGSSDYATLTVGKREPVELTLTFLYNETANSAANTIFDRFQSATPTLGVRWSPRGLVSGARAYATSNDGGATFGLGVITNVTLSALDPSDADPYVAMVTVRTPSLRQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.