NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310343_10009406

Scaffold Ga0310343_10009406


Overview

Basic Information
Taxon OID3300031785 Open in IMG/M
Scaffold IDGa0310343_10009406 Open in IMG/M
Source Dataset NameMarine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5317
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (54.55%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Comprehensive Metagenome And Single Cell Genome Sequencing From The Open Ocean Community Of North Pacfic Subtropical Gyre, Station Aloha

Source Dataset Sampling Location
Location NamePacific Ocean: North Pacific Subtropical Gyre
CoordinatesLat. (o)22.8367Long. (o)-158.0236Alt. (m)Depth (m)25
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014155Metagenome / Metatranscriptome265Y
F030784Metagenome / Metatranscriptome184Y
F103426Metagenome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0310343_100094064F030784GGAGGMFNTYIEDKAMIPVLLAYDWMVSHGTWTDCPYETYVSLKKKVIHNGNAVPLS
Ga0310343_100094068F014155AGGAGMNHQRFKFYHHSTEYYRQLYNSIKQLEDNCKDINYTVLPSTINYKRKSKFIKTNSNTNKTHKKIC
Ga0310343_100094069F103426N/ALDCYNSSIRQAKELDMTNIKTVTNTAFGKTLHYVVDDYYADAIKVLTGKKTINDNDIIALMQLGLTVNNNTLQELIAV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.