NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310343_10146463

Scaffold Ga0310343_10146463


Overview

Basic Information
Taxon OID3300031785 Open in IMG/M
Scaffold IDGa0310343_10146463 Open in IMG/M
Source Dataset NameMarine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1569
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Comprehensive Metagenome And Single Cell Genome Sequencing From The Open Ocean Community Of North Pacfic Subtropical Gyre, Station Aloha

Source Dataset Sampling Location
Location NamePacific Ocean: North Pacific Subtropical Gyre
CoordinatesLat. (o)22.8367Long. (o)-158.0236Alt. (m)Depth (m)25
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001504Metagenome / Metatranscriptome681Y
F007173Metagenome / Metatranscriptome356Y
F049702Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0310343_101464633F007173GAGMQTTTTKAIISRDKLMEYIHEERDLLMGLQDDLSDMLSATGRYSITLDEIVQNYMPFIPLHLIENEDEIKQAYPDRVTDDEYIFIYDRDMTPNEITLNVEWLD
Ga0310343_101464634F001504GGAGMTQDTEHFYAVQSFLEDDELHKIWNIIEIAMEREGYDVQNAELSIRLYDPELTENKGYYNQPEPINYYQGA
Ga0310343_101464636F049702N/AMTLIDFDKKELHDIYSALQYSRLEIGFESKSEEELYNRLTKLMDKVAKLRQVCDCKENVS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.