NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315908_10092524

Scaffold Ga0315908_10092524


Overview

Basic Information
Taxon OID3300031786 Open in IMG/M
Scaffold IDGa0315908_10092524 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2412
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (37.50%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.8268Long. (o)-83.1913Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034567Metagenome / Metatranscriptome174Y
F058818Metagenome / Metatranscriptome134N

Sequences

Protein IDFamilyRBSSequence
Ga0315908_100925242F034567GGAGLKDLFNYYDYVNHYGNRMFAIAGVNAMPARYCSILFTGSYKECMERMNPAGLEGSVEDICQRVAFPK
Ga0315908_100925243F058818N/AMIKELLEKQELLGEIAAELYGDLWIMNEKFWGSPTERELQEVTMGLMNLGYTVEPTPEQEEAAKIVAKKFGFELPPED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.