NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315900_10008794

Scaffold Ga0315900_10008794


Overview

Basic Information
Taxon OID3300031787 Open in IMG/M
Scaffold IDGa0315900_10008794 Open in IMG/M
Source Dataset NameFreshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12918
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (80.77%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Fungal Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Lake Erie, Ohio
CoordinatesLat. (o)41.6898Long. (o)-83.2813Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000369Metagenome / Metatranscriptome1222Y
F000376Metagenome / Metatranscriptome1216Y
F002622Metagenome / Metatranscriptome542Y
F068743Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0315900_100087942F068743AGGAGGMPWKIKQGVAGCKGFAVVKEGGELVGCHPSQSRAAAHMRALYASESDTKKMKDKKKKIY
Ga0315900_100087943F002622AGGAGMEEEEYHDMELERYLEMGVITIEGMDESGEIIFAINESAKDLAPELWESHMRYVDESLLKLYESGYMQVEYDENLEATLHISPEGAELAKEMGLMQINFDEPPNN
Ga0315900_100087945F000376GGAMSTYQEKAKECKCCGKHVPLPTVLKEYHGIQLCPTTFANVIEYKRIWKSAGSRPSGSIRKHFSEYVQQIVENTIDKNEDGTLQ
Ga0315900_100087947F000369AGAAGMEIELADHFDRMNKVVEELLKGNNPTQIASITGFKRADVLGLIDEWKEVVRNDHTARDRAKEAVSGADQHYAMLIKEAWKTVEDADQSGQLSVKATALKLIADIEGKRIGMLQEVGLLDNAELATQIAETERKQEVLVKILKEVTATCPKCKMEVAKRLSQITGVVEPVIIDAEEASGS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.