NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310122_10011107

Scaffold Ga0310122_10011107


Overview

Basic Information
Taxon OID3300031800 Open in IMG/M
Scaffold IDGa0310122_10011107 Open in IMG/M
Source Dataset NameMarine microbial communities from Western Arctic Ocean, Canada - CB6_Bottom_1051
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5498
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (41.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)74.6947Long. (o)-146.6612Alt. (m)Depth (m)3678
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003827Metagenome / Metatranscriptome466Y
F019664Metagenome / Metatranscriptome228Y

Sequences

Protein IDFamilyRBSSequence
Ga0310122_1001110710F003827N/AMAEGRWADWQVRLIAENMAEKRPKRAWFEDDNDNEDYFTSLKSWSHITARQLYSMELEERQLIIFVHHLGIEHIGVETFDPQDKGRYSRQSDFVPSESDAYQDHVEQFQTLNTPPLDIQPKE
Ga0310122_100111074F019664N/AMIDDTEQVDVSDAGAVPATSTNSRVMYQGIFDFAKILNAYYYTPDEWSRQGMWGPLPDERNTELTGVNQDRRDDETSEENIKNYKSQR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.