Scaffold Ga0310121_10451030

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0310121_10451030

Scaffold Ga0310121_10451030

Overview

Basic Information
Taxon OID	3300031801 Open in IMG/M
Scaffold ID	Ga0310121_10451030 Open in IMG/M
Source Dataset Name	Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	721
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location Name	Canada: Western Arctic Ocean
Coordinates	Lat. (^o)	73.0038	Long. (^o)	-140.0007	Alt. (m)		Depth (m)	486
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087038	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0310121_104510302	F087038	GAG	MTKLNQGDLLIEKDGSHAVLMRSVDSLGVRAWRVYWNNSMEDLFPWLETSIQEQIYKGNLKYIKGGY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.