NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308409_1010127

Scaffold Ga0308409_1010127


Overview

Basic Information
Taxon OID3300031830 Open in IMG/M
Scaffold IDGa0308409_1010127 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3038
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5387Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007404Metagenome / Metatranscriptome351Y
F014738Metagenome / Metatranscriptome260Y
F016100Metagenome / Metatranscriptome249Y
F075533Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0308409_10101271F075533N/AGATSVTFRAVINLSDIFGIDAGLLTIALTGRGGCCGVQLPPQTNIKIEKPDANLREIIEQSTDEFVTVRYHRKRFLRDQTLPIIDFRSDSTLTWRFPETTRVTDISKAPNRVFAQYRGYWTDHLTATTSILSLESRRQQLTWRVASVGEYGSKAIAEARRDEAAVALDRQIAPLTVELDNSRYELMTREGVTVPNWAADVSDYAIVPGYFRNAKITSRTITRERTTYTVSFNPDDFVTVL
Ga0308409_10101273F007404GGAGGVDIIEILQLLAAGHNGLTAADYLWNAVFGAIGAATAYLADNEGEVILPRYDAEQHSVELGALGRVLVGAGAGVLVGYSGYIPFIAGVVAPTLLPILIDKVTAFVGRGRK
Ga0308409_10101274F014738GAGGMKLDVLLPVSAFVLAFIHPDAAQVAATAVLLLLTLRIERRRRARKKKSAPASC
Ga0308409_10101277F016100N/AEKTPATNKDIIRPLNYELLVGTHVPEPDWHRLGALVVVLFRSFAAVDVELWLTDAGIWVADALVAFGDRRRLRRGEGETPLHAVIELITDIQRY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.