 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300031834 Open in IMG/M |
| Scaffold ID | Ga0315290_10863503 Open in IMG/M |
| Source Dataset Name | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 770 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.5895 | Long. (o) | -110.359 | Alt. (m) | Depth (m) | 92 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054395 | Metagenome | 140 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315290_108635032 | F054395 | N/A | CGAGVMVKCCDQAIDLPIGPIIEQIGVGQLWEGSLHCGGLFDGSLFDTMAVVRREAGKSLLEGVDVEEGDGKGADATVDAAESTGNLTEQGGGCPLEPVVGFLIQRSRVCQSWNCHGGSFLFDGEVDDEIAFG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |