NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315319_10101205

Scaffold Ga0315319_10101205


Overview

Basic Information
Taxon OID3300031861 Open in IMG/M
Scaffold IDGa0315319_10101205 Open in IMG/M
Source Dataset NameAmmonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 3416
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1408
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater → Marine Archaeal Communities From Monterey Bay, Ca, That Are Ammonia-Oxidizing

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.7468Long. (o)-122.0193Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005608Metagenome / Metatranscriptome395Y
F014511Metagenome / Metatranscriptome262Y

Sequences

Protein IDFamilyRBSSequence
Ga0315319_101012053F005608N/AMKKTTIEVLEEGELIFGSPTVGKYFVRRYEDEVEMGGGFFKTKKEAQTHVREYKKSK
Ga0315319_101012054F014511N/AMGMKNVTIKTVVNEKFRFKAMDLNGAVFVFEDKPSIPIDIACDTWDVKTGEVLQISPPTPKSTASLDLGDWRESLIELNDEYVFT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.