NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315280_10000710

Scaffold Ga0315280_10000710


Overview

Basic Information
Taxon OID3300031862 Open in IMG/M
Scaffold IDGa0315280_10000710 Open in IMG/M
Source Dataset NameSediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)60781
Total Scaffold Genes70 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)50 (71.43%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5094Long. (o)-110.5094Alt. (m)Depth (m)88
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050838Metagenome / Metatranscriptome144N
F068393Metagenome124N

Sequences

Protein IDFamilyRBSSequence
Ga0315280_1000071067F050838GGAGMSIYWVWSYYGKGGKVTEYLKWLSSDEAKLLASQIEKETGMKYLDTYTTILSFGDYDAEDWWAAPDWASLDKMRGCKALAEWTRKTWDMIDQTRPQKSRMMRTAKEVKVIEKPEKWTELL
Ga0315280_1000071068F068393N/AMEEVTRRGRSALGGERTLPTSKEIQQRLDLARTELENSQQQLLESKMVLVQKLREAFPGFVDLAIRRLVEKNASRIDQLSPEELRKMKIEIEKEKPIAIEKALKAFDSCPDWLWCRSSATGYREDPIDDSGVSEEGAIWKVLQGYSRPLEEIFARYGLGVGVPAVPDATVTGYPLKLPYRFLEDHALKELNIAVGEAHEGFCRAKRDVEVLEIQLKETGALEKFESA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.