Scaffold Ga0315314

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0315314_1006243

Overview

Basic Information
Taxon OID	3300031877 Open in IMG/M
Scaffold ID	Ga0315314_1006243 Open in IMG/M
Source Dataset Name	Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9
Source Dataset Category	Metagenome
Source Dataset Use Policy	Restricted
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components
Scaffold Length (bps)	8436
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	13 (86.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Freshwater Sediment Microbial Communities From Lake Towuti, South Sulawesi, Indonesia

Source Dataset Sampling Location
Location Name	Indonesia: South Sulawesi
Coordinates	Lat. (^o)	-2.7726	Long. (^o)	121.4938	Alt. (m)	Depth (m)	4
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006925	Metagenome	362	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315314_100624311	F006925	GAGG	LGVHVEVLEGFGRELALRKKWMKMWDTLGERILKMPKWMQNIVLEDINTAVRNRVAIMEMIQNAKRGN

⦗Top⦘

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.