NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318522_10056279

Scaffold Ga0318522_10056279


Overview

Basic Information
Taxon OID3300031894 Open in IMG/M
Scaffold IDGa0318522_10056279 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1399
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015406Metagenome / Metatranscriptome255Y
F053577Metagenome / Metatranscriptome141Y

Sequences

Protein IDFamilyRBSSequence
Ga0318522_100562791F053577N/AATDVFGLTGTAARAAAEACRRGTDAVSAARSFLDDLRGHR
Ga0318522_100562793F015406N/AYDGDDPQVRGAAMRRWNDTKAVWGQVPGTFRAAGHGGVGYLFDTLARNDTVTLTTGQLRIGGPELYYLDYSSWQGRPGPLVMACDGEQYWGIHDNRARVGPARPMLGGFADLVGSSWLLGERLSGGVEITYHGRRGYHLRVTRGDGAAHEGPTMFYPADAIVDAETGSLLRLIAYDGDAPAEWWELDGITTEPGDTADPAGFRPHIPPGTRVVEETGNPLIDNATDVFGLTGTTTRQHVKAAGPWSQYAGGDREP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.