NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318551_10049346

Scaffold Ga0318551_10049346


Overview

Basic Information
Taxon OID3300031896 Open in IMG/M
Scaffold IDGa0318551_10049346 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2116
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002127Metagenome / Metatranscriptome591Y
F005673Metagenome / Metatranscriptome393Y
F022254Metagenome / Metatranscriptome215Y

Sequences

Protein IDFamilyRBSSequence
Ga0318551_100493461F022254GGCGGMAKPPRDRRTQPARQRTDIRLHARVDHLEDAISHFYNVINELRRRVSTLEKKLKPLAKDDLNGG
Ga0318551_100493464F002127GGCGGVDLRKLLHRVETAPIGSPELDSEFESTFRSVPSHVTRSIDAAARLIETELPGWWWNCGHCALRNGASLYVPGSSQIRVNYPSAGIGPDFGPRPEHLRLLHDPKWGKLFDGGFHCDRAATVALAMLAVFLEAKIALTFVQPEASANKVIRSNK
Ga0318551_100493465F005673N/AMNSDREIADAIKAAQRLLWHTYDLPDAMKVVRLRKFVRSPIVQYALQRSSDTLLAITLRAVELVIADQSRTDREMIGRLWGILLNNPHLIQAMWP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.