NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0306923_11501313

Scaffold Ga0306923_11501313


Overview

Basic Information
Taxon OID3300031910 Open in IMG/M
Scaffold IDGa0306923_11501313 Open in IMG/M
Source Dataset NameLab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)705
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium ADurb.Bin183(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F034427Metagenome / Metatranscriptome174Y

Sequences

Protein IDFamilyRBSSequence
Ga0306923_115013132F034427N/ACFVVRSLRIAADMLLTHASHPDPFEANGRSLTYDTMH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.