NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307412_10247446

Scaffold Ga0307412_10247446


Overview

Basic Information
Taxon OID3300031911 Open in IMG/M
Scaffold IDGa0307412_10247446 Open in IMG/M
Source Dataset NameMaize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1383
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Sphaeropleales → Selenastraceae → Monoraphidium → Monoraphidium neglectum(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere → Maize Rhizosphere Microbial Communities From Greenhouse At Uc Davis, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5Long. (o)-121.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000818Metagenome / Metatranscriptome878Y
F004649Metagenome / Metatranscriptome429Y
F020088Metagenome / Metatranscriptome226Y

Sequences

Protein IDFamilyRBSSequence
Ga0307412_102474461F000818AGGAGGVDQQNVSPEGTKARFRIEPLEDRIAPAIVAVQINGGGNTPQGNANGVPVTNLNPAGHAPPGQN
Ga0307412_102474462F004649AGGAGGMDQSKLSGQDTQNRFRIEKLEERIAPSSANFPPGQFPSGNPAQAPGNSNPNEVPSNNPSN
Ga0307412_102474463F020088AGGAMQQQNEQTKRFRIDQLEERIAPAIVLVNPGGNTPQGSGANNGEAIEAQNPAGHAPPGQN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.