NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0308417_1121090

Scaffold Ga0308417_1121090


Overview

Basic Information
Taxon OID3300031950 Open in IMG/M
Scaffold IDGa0308417_1121090 Open in IMG/M
Source Dataset NameHot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)899
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.5341Long. (o)-110.798Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000855Metagenome / Metatranscriptome859Y
F001381Metagenome / Metatranscriptome709Y
F011940Metagenome / Metatranscriptome285Y

Sequences

Protein IDFamilyRBSSequence
Ga0308417_11210901F011940N/ALPTATRDPYQPPSAVPRYTLAPVTPPPFGDDVSWDGSLVGDLLDGLEALGRAVAPPAARICDLPVPVLADAPEYGFRDALPDFVAGLCGFFSVASPVLGFVRLPVTLMVIGFVFWSAWRVFRSLS
Ga0308417_11210902F000855GAGGVDWLEDFWSKIVSWFDELSAGVHNGVIGWVNSLVEIWNGWMDALLHPAQAMPSSPQLRWIVDWLGGMADYTRLMYMLVDYVAYAGIVQQALIAQLTIVTIGLAFRAWLVIRRIVLVS
Ga0308417_11210903F001381GAGMQYVIATLYVLCWLALAALAALVLPRWALPAALVQLAVAYVMLRSWLTAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.