NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307479_10002295

Scaffold Ga0307479_10002295


Overview

Basic Information
Taxon OID3300031962 Open in IMG/M
Scaffold IDGa0307479_10002295 Open in IMG/M
Source Dataset NameHardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)17376
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)20 (86.96%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)39.0844Long. (o)-86.4705Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000414Metagenome / Metatranscriptome1169Y
F001759Metagenome / Metatranscriptome640Y
F002337Metagenome / Metatranscriptome569Y
F008209Metagenome / Metatranscriptome337Y

Sequences

Protein IDFamilyRBSSequence
Ga0307479_1000229519F001759AGGAMTLKSALQDLRETTLDAVSGLLAKLAYLGSLRRREGGYLHWGMSLVHGEEASDRALKAAHTEALSNVLRRPIGDLTEDLQKSTQNSEQTAGAFVDDMREQFNDLLPSPEDAASARHLNSVLVALSSLEKNQKRATPSASSPPLPPGQ
Ga0307479_1000229520F008209GGAGGMKISRLLFQNKEKTNVKRALLIVAAALMFLNTLVVPTLVHADGGSGGGNCSGSTGNCKP
Ga0307479_1000229522F002337GGAGMNLAIVLVIAAVFALATILSVAVTRSLQTSKQSACLTGTIRPIDVEAFRNLIDPDEDEYLRRRLPAAQFRTVRRERLRAMAAYVHVAAGNAAVLVRVGDAAVANGDVQVAEAAHQLVNDALLLRRNCILALGRIYLALAWPNSGFAAARVFERYERVSGAAMLLGRLQNPRAAVRLSAL
Ga0307479_100022959F000414AGGAGMSAPSRRPEIRRRRARQHKISTLRKRLAAAQADADRNRILAKLHKLAIASPGQPLVK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.