NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318569_10072313

Scaffold Ga0318569_10072313


Overview

Basic Information
Taxon OID3300032010 Open in IMG/M
Scaffold IDGa0318569_10072313 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1527
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000416Metagenome / Metatranscriptome1167Y
F001379Metagenome / Metatranscriptome710Y

Sequences

Protein IDFamilyRBSSequence
Ga0318569_100723131F001379AGGAGGMGRSIILATDVDAGRARVFEVLSTTEGQRSFWTADCDVAGDHARFGFPQAPVDLVTDVTTEPGKLVRMHVTTGFPFWDGSTWEWELGEAHRATAGTGVLFRHYGFGEGYAELDLGHTAQTWALILDRLAGYLASGNAQPFFP
Ga0318569_100723134F000416N/AVTSRPTGRRAWPWKGASVSEVPAEVWESDDCVRRTVVLPALLAERLAARAEKRGLSFSDLLVEYAEDGLRRDGADGP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.