NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318569_10151204

Scaffold Ga0318569_10151204


Overview

Basic Information
Taxon OID3300032010 Open in IMG/M
Scaffold IDGa0318569_10151204 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1068
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F083041Metagenome / Metatranscriptome113Y
F095850Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0318569_101512041F083041GGAGGVRAVAMLLHAQLRQHWRSWLALAALVTLVGGLVMAAAATARWTAAAFPGFLARHGYDAVVYSSHPLPSLARLPQVAHVTPAPGPISFAGRCAPCRQPIGVGNFGVFEVPPADLGRMVKLLSGRMPDQSSPDEVLASYTLARDNGVRIGTVIQVLTPTPAQLRIAQKVGRSKVNPAAVPRR
Ga0318569_101512042F095850AGGAGMSYLTGLARFTTLAAQGTQMSAGPSQPARSDPVASRRKRVTIGIVLWWFLRWPLDRRFWHTMAMLAIAFGAARASGRDSRARMVAWDIRQRERAMKAAAAHAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.