NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326509_1156644

Scaffold Ga0326509_1156644


Overview

Basic Information
Taxon OID3300032036 Open in IMG/M
Scaffold IDGa0326509_1156644 Open in IMG/M
Source Dataset NameMetatranscriptome of bovine rumen microbial communities from UC Davis, California, United States - 2_2465_0518 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)796
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5357Long. (o)-121.7593Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030954Metagenome / Metatranscriptome183Y

Sequences

Protein IDFamilyRBSSequence
Ga0326509_11566441F030954N/ASQYGQSFPQAGQPTYKEIARGVGIDPRELEAIKSVAFSVFQSGVNPMAKDISEGIKQKLGGEWFAFVNPAGDETYEFSLTRVKGTDFVSFVLNGTTKFQVCRIKAY
Ga0326509_11566442F030954N/AYSQTSGQPTYREIARGVGIDPRELEAIKRVAFQVFQSGVSPMAKDISEGIKQQLGGEWFAFVNPAGDETYEFSLTRVKGTDFVSFVLNGTTKFQVCRIKAY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.