NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0326512_10385283

Scaffold Ga0326512_10385283


Overview

Basic Information
Taxon OID3300032038 Open in IMG/M
Scaffold IDGa0326512_10385283 Open in IMG/M
Source Dataset NameBovine rumen microbial communities from UC Davis, California, United States - 1_2617_0518
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1121
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Rumen Microbial Communities From Sheep, Dairy Cows And Beef Cattle From Various Locations

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)38.5357Long. (o)-121.7593Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F065282Metagenome / Metatranscriptome127Y
F092990Metagenome106N

Sequences

Protein IDFamilyRBSSequence
Ga0326512_103852832F092990GGAGGMSKSDQIALGRNQGLDLARRIVAQAQADGIDPLKALDMEIRSRHIIGIAAKMTKSEWEKEFAAAMELAYKAAMVIAMAVLWGDFGWGGVKRLPKFCSAYLNYLMEIGRQNTSITELVDLLETKAGVHVDLAEKGFTADFRKAKGKDKIA
Ga0326512_103852833F065282N/AMTEEKHECKTYAEMLAVLREAKAAGHTAWWNSEELRNGELIVYVRKNGKENENG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.