NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315305_1009584

Scaffold Ga0315305_1009584


Overview

Basic Information
Taxon OID3300032127 Open in IMG/M
Scaffold IDGa0315305_1009584 Open in IMG/M
Source Dataset NameMetatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_Tmax_529 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2281
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location
Location NameCanada: Western Arctic Ocean
CoordinatesLat. (o)77.9995Long. (o)-150.0065Alt. (m)Depth (m)370
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060053Metagenome / Metatranscriptome133N
F065855Metagenome / Metatranscriptome127N

Sequences

Protein IDFamilyRBSSequence
Ga0315305_10095841F065855N/AMTKLDEGMRAPVKELPYTRANFTASKYGLKFIIHEEARLKNVHNVLQDTIQVASNKIEQRQSFDVIGELNTNLTAQAAAGVWDTFVASTDRSTNDPTIDLGIASLNIEGSGVGGKMNRVGMHQLTYAKFTGNTFLRGVASNGARDYSYEPGTSELSGIPGIGLVLDNSIQQGEVYAVDTELEPTCALFQGPQRVGSQHDEETGDDKYFVIDYHLATIIQSETGRQITGCTTPLAW
Ga0315305_10095843F060053AGGAGGMAFGRTPAGTISRETIISTRRLSVKGSTTITKGNVCELSSGYLIPCAASGTPTADVAHFVALQTIDNSSGANGAVTAPVAVTGHYVLVVADGAISPGARVQISASTAGQVITAAGDIDIQVGTYFGKEGGIVSKSASTPFLESFTDDQDFPPVACADGDVVEVLLI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.