NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316201_11078843

Scaffold Ga0316201_11078843


Overview

Basic Information
Taxon OID3300032136 Open in IMG/M
Scaffold IDGa0316201_11078843 Open in IMG/M
Source Dataset NameCoastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)673
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7869Long. (o)-75.1074Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055745Metagenome / Metatranscriptome138N

Sequences

Protein IDFamilyRBSSequence
Ga0316201_110788431F055745GGTGGMVIKNFGYDDDIFDDQFQQQFATKAEISPVVSQEEAERAAKIANSYPNLPPSVIAAAAQLGLGFDDNRLEEIAKKAAVQKENAFNKIKRFTSENPLANQIKNNRFFQVASSPIDNIVKPAVRNLVSGLLDINEASFGAN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.