NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315912_10000818

Scaffold Ga0315912_10000818


Overview

Basic Information
Taxon OID3300032157 Open in IMG/M
Scaffold IDGa0315912_10000818 Open in IMG/M
Source Dataset NameGarden soil microbial communities collected in Santa Monica, California, United States - V. faba soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)46022
Total Scaffold Genes33 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)22 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.0136Long. (o)-118.4673Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035830Metagenome / Metatranscriptome171N
F052451Metagenome / Metatranscriptome142Y

Sequences

Protein IDFamilyRBSSequence
Ga0315912_1000081824F052451GAGGMLAVLCHGRYELLKAGVHGAALGIAAICTAYNFGAWVARRQRHSWVNATLYGALTAWEYHHVRHHLDCRVVRTGGQTDEQKAA
Ga0315912_1000081828F035830N/AMKTVLKLVIAVALLNAVVRGADSAWNYYQLKDAAQRALLFGTQASSRQIHEQIMERANELRIPLVPNNLTVSWRAGRRIAEANYTQPIEFFPRYQYPVLFSFNVDTVSVGTPPDDESYPPVRK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.