NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0315912_10013241

Scaffold Ga0315912_10013241


Overview

Basic Information
Taxon OID3300032157 Open in IMG/M
Scaffold IDGa0315912_10013241 Open in IMG/M
Source Dataset NameGarden soil microbial communities collected in Santa Monica, California, United States - V. faba soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6931
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.0136Long. (o)-118.4673Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015483Metagenome / Metatranscriptome254Y
F032460Metagenome / Metatranscriptome180Y

Sequences

Protein IDFamilyRBSSequence
Ga0315912_100132414F032460GGAGGMKSEQAKPLQVAAQHAARWCMEKLEMKEGGFGKNHEHSDSERAALHVAHSIAICEIARLQPIVEGR
Ga0315912_100132415F015483N/ALGDQEIEIAIRQAGYDIRWETAADGARTVHALRDGKRHTQSHPTLLALAQYLGRVERPVQFVEDRNALESAISKHGEEQRPFAVRRDACRIALFRSLKYVQLVSAAGDAAMYELRDGGVRRTSKGNLPLEVVAAFAAVTAPILR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.