NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0311301_11444582

Scaffold Ga0311301_11444582


Overview

Basic Information
Taxon OID3300032160 Open in IMG/M
Scaffold IDGa0311301_11444582 Open in IMG/M
Source Dataset NameSb_50d combined assembly (MetaSPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)853
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000451Metagenome / Metatranscriptome1124Y
F026958Metagenome / Metatranscriptome196Y

Sequences

Protein IDFamilyRBSSequence
Ga0311301_114445821F026958AGGCGGMGDQAEKVVLEAEDQVSPVVDRANAGLERFEQKAESAHGKVIRITDQTRSSVQRLIASLEKQAETYGKS
Ga0311301_114445822F000451AGGAMPRFQTVLRRARFVYSPYTAYEMQGFAQVLADAIRARIQSGRNIYDQPAAPLKPGKPGRRGYPDYKSVRGLQPIRDWTWSGHTLRCLKVLTANENRAVIGFLDEALPGRRQTASQIAFYNNQRERQWGVSPRDRQALLAAMLRPVVSVKAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.