Scaffold Ga0307471_100003262

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307471_100003262

Scaffold Ga0307471_100003262

Overview

Basic Information
Taxon OID	3300032180 Open in IMG/M
Scaffold ID	Ga0307471_100003262 Open in IMG/M
Source Dataset Name	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9633
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location
Location Name	USA: Indiana
Coordinates	Lat. (^o)	39.0844	Long. (^o)	-86.4705	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006351	Metagenome / Metatranscriptome	375	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307471_1000032628	F006351	GGAGG	MARPRPEKKREPRAAAGTKILPMELQVGDRLADGTSDWEVIAPPYSTAGGRMVHARAQKIDQPASWEIRNWDAVKPISVKRATAEEDKR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.