Scaffold Ga0307471_100884337

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0307471_100884337

Scaffold Ga0307471_100884337

Overview

Basic Information
Taxon OID	3300032180 Open in IMG/M
Scaffold ID	Ga0307471_100884337 Open in IMG/M
Source Dataset Name	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1060
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil → Hardwood Forest Soil Microbial Communities From Various Locations In The United States

Source Dataset Sampling Location
Location Name	USA: Indiana
Coordinates	Lat. (^o)	39.0844	Long. (^o)	-86.4705	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003957	Metagenome / Metatranscriptome	460	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307471_1008843372	F003957	GGA	MRWLFVAALALLGATRVMAQDDERWQVTLNDGRIIWELQLVRMRGDTLVARHADSTYRFPLSQLDELRLVVKAERHQTPEPDRYGGVLNGADDEIYRLTLYSVPERRDILAKIFKDHPPPSPGSR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.