NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0306920_101205882

Scaffold Ga0306920_101205882


Overview

Basic Information
Taxon OID3300032261 Open in IMG/M
Scaffold IDGa0306920_101205882 Open in IMG/M
Source Dataset NameLab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1093
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000602Metagenome / Metatranscriptome995Y
F008042Metagenome / Metatranscriptome340Y

Sequences

Protein IDFamilyRBSSequence
Ga0306920_1012058821F008042GGAMVRRRFIFFDVGNTLLFPNRARMLEPIAAEKHPSLEAWQALERRTKDEFDRGLISGNIDHGFWWTFHTHLLHQLDAFDEGVRDQLVENTQNSANWDQILPGTREVLDRIRA
Ga0306920_1012058822F000602AGGMVIAVSALLASFTRSTRAVFAVYTATRATAAMLVGLAMAVVSREPRQDIYNILWAVVFGFATLNILGLATRRMEPSRRRMTFGELMAVTVVAVSIFLLGWEMLSVLHIFPIKLKQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.