Basic Information | |
---|---|
Taxon OID | 3300032262 Open in IMG/M |
Scaffold ID | Ga0316194_10011051 Open in IMG/M |
Source Dataset Name | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6164 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Sediment → Sediment Chemolithoautotrophic Microbial Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Maine | |||||||
Coordinates | Lat. (o) | 43.917 | Long. (o) | -69.6219 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F073087 | Metagenome | 120 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0316194_100110513 | F073087 | AGGA | MNTQHQTSFTKAIIGSTQRLFHSNKNQNLLATNCVDARTMKDIGFNPVGQF |
⦗Top⦘ |