Scaffold Ga0316189_10040629

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0316189_10040629

Scaffold Ga0316189_10040629

Overview

Basic Information
Taxon OID	3300032272 Open in IMG/M
Scaffold ID	Ga0316189_10040629 Open in IMG/M
Source Dataset Name	Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4041
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (87.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location Name	USA: Maine
Coordinates	Lat. (^o)	43.9353	Long. (^o)	-69.5766	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F024001	Metagenome / Metatranscriptome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316189_100406296	F024001	GGA	MFQVKGSRINKITILGVETPVWQGAKTQEYLDIPSFRNAAKRDASAYEM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.