Basic Information | |
---|---|
Taxon OID | 3300032272 Open in IMG/M |
Scaffold ID | Ga0316189_10385994 Open in IMG/M |
Source Dataset Name | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1084 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Maine | |||||||
Coordinates | Lat. (o) | 43.9353 | Long. (o) | -69.5766 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F054044 | Metagenome / Metatranscriptome | 140 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0316189_103859942 | F054044 | N/A | MDYRNSDRLNHPSADRLGIFHTVGILVLVFALTALILLFLDSSFRSAADPEECHQLVRALGLNSLSLAPTGRPLRNPGAIDPLVDLRFDPKLGRIHLDGADFVLKVSD |
⦗Top⦘ |