NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316188_10059172

Scaffold Ga0316188_10059172


Overview

Basic Information
Taxon OID3300032276 Open in IMG/M
Scaffold IDGa0316188_10059172 Open in IMG/M
Source Dataset NameCoastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1833
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Maine
CoordinatesLat. (o)43.8293Long. (o)-69.8133Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F042909Metagenome157Y
F093888Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0316188_100591721F042909AGGAVVDFLTFIGSLNLGTFIVIWTSTIFLVIFISLLLVYVSQMNKETIRLSKNVKILIEELSEKKLKLGDDDL
Ga0316188_100591722F093888GGAMTPLASICALVIIFSLTLFGILILIKVRNIKKVLNNLNDGLDIINQKLGRQSMEFKKIQPNRHKLGSHINNEIAAGGRASLEAGNSAEIAQKNRSEEHRINTEIRTKIQALLKKSGKPTPYHDLTKHLSKDYPDYDYDFFLKEVEDLQKQGKVEVQLIAGKLYFQIKKT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.