NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316202_10209536

Scaffold Ga0316202_10209536


Overview

Basic Information
Taxon OID3300032277 Open in IMG/M
Scaffold IDGa0316202_10209536 Open in IMG/M
Source Dataset NameMicrobial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)905
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Maine
CoordinatesLat. (o)43.8603Long. (o)-69.5781Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001582Metagenome / Metatranscriptome668Y
F081914Metagenome / Metatranscriptome114Y

Sequences

Protein IDFamilyRBSSequence
Ga0316202_102095361F081914GAGGMSEYRLETEEDMSAYLDIEYGHGVSAVYTNSSGTAATINVILNNEYVEQEEGIGVEALKPIAYCRTVDVP
Ga0316202_102095362F001582AGAAGMPLESAADFNSYVDINTGHGVTATFFEVQNNLWDSRTSLIDTWFDIDSGASTNINIIIDQEYFNIEGGTVPVAGYQPRAIVKSTDVPYISQLDRLVVNAITTNKGSVLKPETTFLVRTVEPDNTGFVSLVLEEQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.