NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310345_11682504

Scaffold Ga0310345_11682504


Overview

Basic Information
Taxon OID3300032278 Open in IMG/M
Scaffold IDGa0310345_11682504 Open in IMG/M
Source Dataset NameMarine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)620
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Comprehensive Metagenome And Single Cell Genome Sequencing From The Open Ocean Community Of North Pacfic Subtropical Gyre, Station Aloha

Source Dataset Sampling Location
Location NamePacific Ocean: North Pacific Subtropical Gyre
CoordinatesLat. (o)22.7719Long. (o)-158.0Alt. (m)Depth (m)500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001922Metagenome617Y
F021317Metagenome / Metatranscriptome219Y

Sequences

Protein IDFamilyRBSSequence
Ga0310345_116825041F001922N/AMIQKLLVEEGMKRGLKASREYSVSVLGYDFIGLISRLAIFFITGFLINSYFQATIQGGIWLNSLAGFFGLNFPTTLPEWTTKLFTTGFHNITFWQIVQVISVLIVVMEYMQYDRMLKEKQEKPNITTGAVFAMIGLGLSLITFPQIVQKIQEM
Ga0310345_116825042F021317N/AKTIAEQKAQGVSDEQMKGIYQKKQMLELVTNNAEVINIIGKPIIKKLLGFVKSI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.