NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316204_10371187

Scaffold Ga0316204_10371187


Overview

Basic Information
Taxon OID3300032373 Open in IMG/M
Scaffold IDGa0316204_10371187 Open in IMG/M
Source Dataset NameMicrobial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1092
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Maine
CoordinatesLat. (o)43.8603Long. (o)-69.5781Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006845Metagenome / Metatranscriptome363Y
F012117Metagenome / Metatranscriptome283N

Sequences

Protein IDFamilyRBSSequence
Ga0316204_103711872F006845AGGMKSYRKRMDLNSYLLEEDFEQFCRYAYERVSAACDYLGIINDETFEDFKERNYASLESDYINSIDRTIH
Ga0316204_103711873F012117GGAGMVDILGGMSNSNSESQQVYLAFKTSHQQFFANGETPVEFQYLQLDPSTFKSGWGRYTKAEGFEYHWDDKFGVVAPKPADDYKRAFSAWVFPQGAQHAYLWQRFTYAESSAFNSILGSFWNQMDSSSANLPVVKYEGSKPIQVGMGNSSELSFSFAKFAPRTAEFVIPSWYLEQEAPVEDTFKSPNDGLADKVQEMVDKNELSDDDIPF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.