NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0316204_11157278

Scaffold Ga0316204_11157278


Overview

Basic Information
Taxon OID3300032373 Open in IMG/M
Scaffold IDGa0316204_11157278 Open in IMG/M
Source Dataset NameMicrobial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)541
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat → Sediment Chemolithoautotrophic Microbial Communities From Various Locations

Source Dataset Sampling Location
Location NameUSA: Maine
CoordinatesLat. (o)43.8603Long. (o)-69.5781Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048232Metagenome148N
F090273Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0316204_111572781F048232GGAMLNAESLPYEERVSRIMFLREHRRNLLQAYCKDDVTKKEKDKLRLEIARVQKALKKLDPDGMFPP
Ga0316204_111572782F090273N/AMKYWFDTDDAQRWGLPAAAVLAHLKYWIERNTSAGEEPCMTQGIKEMAEYLPFLTPSKIKRALVKLEEVEAIYRKPNGFDRRHTYCLGTI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.