Scaffold Ga0325400_1001454

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0325400_1001454

Scaffold Ga0325400_1001454

Overview

Basic Information
Taxon OID	3300032374 Open in IMG/M
Scaffold ID	Ga0325400_1001454 Open in IMG/M
Source Dataset Name	Populus deltoides microbial communities from Bellville, Georgia, United States - Xylem-PdKOR-R1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	19553
Total Scaffold Genes	23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (47.83%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Salicaceae → Saliceae → Populus → Populus trichocarpa	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Wood → Unclassified → Unclassified → Xylem → Understanding The Reciprocal Impacts Of Modified Plant Cell Wall And Associated Microbiome

Source Dataset Sampling Location
Location Name	USA: Georgia
Coordinates	Lat. (^o)	32.1348	Long. (^o)	-81.9657	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089606	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0325400_10014541	F089606	N/A	MYFEILDSVIMRLRMMILSLIIDLEYFQFGPSILGIYILVPELYENCNSAPGSF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.