NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0352981_1023240

Scaffold Ga0352981_1023240


Overview

Basic Information
Taxon OID3300032649 Open in IMG/M
Scaffold IDGa0352981_1023240 Open in IMG/M
Source Dataset NameMetatranscriptome of Cow rumen microbial communities from the University of Illinois at Urbana-Champaign, USA - Cow X-3 corn stover (Eukaryote Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)972
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen → Fungi-Associated Bovine Rumen Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa, For Metatranscriptome Analysis

Source Dataset Sampling Location
Location NameUSA: Illinois
CoordinatesLat. (o)40.102108Long. (o)-88.227299Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F072953Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0352981_10232401F072953N/AVSIVLLYAFFAFLLSLNGEKKEGQEKHLVLLGGESRLDTVGKKTHLLHLGNTTLATDGGKNLLGLAEVDNIDGAAETVLHILDHAADVGDMRALVIDGLIGLILTSKRTSETDHTGVLALGLDREHNSGGELIVSSALAVINLDNVDGIPSTLHGLTLLRLILGLLEEDASGKTIVKVPAVNGGDTTFIIKITIDVEDIVHSDLHLTELSGGHGTIRQGGIVAVGPGATIAISITIVIAKEVVTLLLLIVGDLKRLINSAEKILDQVRNEVDQASKVVLELGRRETTHKVKSTVELVCHS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.