Scaffold Ga0316225_1012647

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0316225_1012647

Scaffold Ga0316225_1012647

Overview

Basic Information
Taxon OID	3300032675 Open in IMG/M
Scaffold ID	Ga0316225_1012647 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4377
Total Scaffold Genes	19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	18 (94.74%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Microbial Communities From Trout Bog Lake Hypolimnion, Wisconsin, Usa

Source Dataset Sampling Location
Location Name	USA: Wisconsin
Coordinates	Lat. (^o)	46.0411	Long. (^o)	-89.6861	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055446	Metagenome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0316225_10126471	F055446	GAG	MAIKNKKYNYYKLNVGFFPDIVKLCFDNTVFQQILKDHDVTLKANALDCGIAETHLIGDGKDAIIILVFDMSLVNDNLSELVDTIAHEVSHAVDHLAEHIGEEDNFVNETRAYLSGHLAGQIFKICLHEKEKHARKASGKLLKQKSKRVKGPELQVDQLS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.