Basic Information | |
---|---|
Taxon OID | 3300032743 Open in IMG/M |
Scaffold ID | Ga0314707_10707330 Open in IMG/M |
Source Dataset Name | Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 513 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Seawater Microbial Communities From Espelandsvegen Fjord, Bergen, Norway |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Norway: Bergen | |||||||
Coordinates | Lat. (o) | 60.2696 | Long. (o) | 5.2187 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F057086 | Metagenome / Metatranscriptome | 136 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0314707_107073301 | F057086 | N/A | LLVMAFGQLYSGQNPSKYKIEGKYDIPVGYKVIIKWDNDEIVFMTKKGNQGPEFQIIYCPKSPVPEDFTIFEWNGNIGEIWDQFLTVVESKEERDIRFFDQGPWRVFGVTRDEVQIALKNHAEARTNVHGILYCADSVNNQPLLEEYMVYLGFDEKIDENFVWLPEEFMQE |
⦗Top⦘ |