NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335078_10000010

Scaffold Ga0335078_10000010


Overview

Basic Information
Taxon OID3300032805 Open in IMG/M
Scaffold IDGa0335078_10000010 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)386852
Total Scaffold Genes324 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)225 (69.44%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5065Long. (o)-80.2537Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000348Metagenome / Metatranscriptome1250Y
F000872Metagenome / Metatranscriptome851Y
F001329Metagenome / Metatranscriptome721Y
F001399Metagenome / Metatranscriptome705Y

Sequences

Protein IDFamilyRBSSequence
Ga0335078_10000010141F000348N/AVRTAIDRIVVLPQSVCFAEGVSDPPELKKALLILAAVVLAPILVVSVAVRAAGDWRPIGQTSEGDKISVSSVRILRNNQRSALVRVEYKSPAELPQGGPFVEVRARVRFNCTSGAASPSAEWFYTRDRGGRIVVGKKATHDDQFGKKPEGGFLDLASKSVCSQEK
Ga0335078_10000010182F001329AGGGGGMSQNHYQTKPKRRQKNAKRKDPSAATMAKLRQLAAADSKKSS
Ga0335078_10000010235F001399GGAGGMKLNDSITTYDIAEALQGESGKFEVTSPNGERYFVTCQPGHSISSLEWAGNEPNLQPFLVRKVAQPITTEGRSKRSAA
Ga0335078_10000010248F000872GGAGGVLKTAAAVLVFLGIAFCSTSMSAQILPRGNVYAGVSYGQMTNVVNRQSYRGWNGSAEDLPFSRIPYLGIVLDVSGFYRSGVTQYNALLGPRVSANYGKWRPFVHALGGIQRISSAGNYYNPIAMDFGGGADYKLFFKNFSWRVQGDYMHTHYATAYQNDFRASTGIVWRF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.